DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and mlp-1

DIOPT Version :10

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_001367782.1 Gene:mlp-1 / 175847 WormBaseID:WBGene00003375 Length:115 Species:Caenorhabditis elegans


Alignment Length:106 Identity:34/106 - (32%)
Similarity:51/106 - (48%) Gaps:9/106 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KCHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGALFGPQLFG 67
            ||.||||.||.||...:.||.||..|.:|..|.|.|:.....||::..:|. .|:...:||:..|
 Worm    10 KCPKCGKSVYAAEEMSAGGYKWHKFCFKCSMCNKLLDSMSCCEHQAQLFCK-QCHCRRYGPKGIG 73

  Fly    68 HG-----TRVESHKSYG---VKGAQKPTGAQANGPPLPRDH 100
            .|     ..:::.:.:|   |....:|..|:|...|:...|
 Worm    74 FGIGAGSLTMDTGEQFGNTEVDMTNRPMTAEAFTAPINPSH 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785 21/52 (40%)
RA_RASSF2_like 660..746 CDD:340482
SARAH_RASSF2-like 757..801 CDD:439180
mlp-1NP_001367782.1 LIM1_MLP84B_like 10..63 CDD:188788 22/53 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.