DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and RASSF6

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_958834.1 Gene:RASSF6 / 166824 HGNCID:20796 Length:369 Species:Homo sapiens


Alignment Length:324 Identity:99/324 - (30%)
Similarity:150/324 - (46%) Gaps:75/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 KKPYQQGRQLFEKGINRSKSGPSCFVYSD------SDDDDEATLRPQRMATIRRSDIPQRYIQIQ 556
            |:|.|...| .||..:...|..|..|:|.      .:.||     ..|::.:.|:.||.      
Human    99 KRPIQLKIQ-DEKPFSSFTSMKSSDVFSSKGMTRWGEFDD-----LYRISELDRTQIPM------ 151

  Fly   557 MDCYPKENVAAASEGESSRADAPSITSGAA---AGDELTQTEDLYTASEGVDGPDGDGSAGLHVT 618
                        ||..:|:.|..|..|...   |.||                            
Human   152 ------------SEKRNSQEDYLSYHSNTLKPHAKDE---------------------------- 176

  Fly   619 EDGVVLRRPPRTGASAIKRRSG---NRRSRTKLKRRCSINGHYYNRETSFFTPPYGSQMSVWVSS 680
            .|..||.|.....|...||...   :|:.|.  |.|.|||||:||.|||.|.|.:.|:..|.|:|
Human   177 PDSPVLYRTMSEAALVRKRMKPLMMDRKERQ--KNRASINGHFYNHETSIFIPAFESETKVRVNS 239

  Fly   681 MVTTTEVINLVLEKYKVDSSPGNFSLFIVRDNGEQKRLKDDEYPLITRVTLGPHEDVARIFLVDS 745
            .:.|.|||..:|:|:|:::||.:|:|.|:...|||:|||..:.||:.|:..||.|..|||||:| 
Human   240 NMRTEEVIKQLLQKFKIENSPQDFALHIIFATGEQRRLKKTDIPLLQRLLQGPSEKNARIFLMD- 303

  Fly   746 RKTDEISNEVAQFLNLSLPECRAILERYDQELAREVAKIKERYAE--------LRRRIVSRMES 801
            :..:|||::|||::|.......:||:|.::|..||:.:|..::.:        |:.::|.:.|:
Human   304 KDAEEISSDVAQYINFHFSLLESILQRLNEEEKREIQRIVTKFNKEKAIILKCLQNKLVIKTET 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 39/83 (47%)
Nore1-SARAH 762..799 CDD:293125 9/44 (20%)
RASSF6NP_958834.1 Ubiquitin_like_fold 219..305 CDD:391949 40/86 (47%)
Nore1-SARAH 319..357 CDD:374597 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157839
Domainoid 1 1.000 80 1.000 Domainoid score I8603
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I3848
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1043350at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41862
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5365
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.