DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and RASSF1

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_733832.1 Gene:RASSF1 / 11186 HGNCID:9882 Length:344 Species:Homo sapiens


Alignment Length:177 Identity:51/177 - (28%)
Similarity:81/177 - (45%) Gaps:32/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 RRPPRTGASAIKRRSGNRRSRTKLKRRCSINGHYYNRETSFFTPPYGSQMSVWVSSMVTTTEVIN 689
            ::||    |....|.|..|. |.::||           |||:.|. .:...:.|.|.....|||.
Human   184 KKPP----SLQDARRGPGRG-TSVRRR-----------TSFYLPK-DAVKHLHVLSRTRAREVIE 231

  Fly   690 LVLEKYKVDSSPGNFSLFIVRDNGEQ---KRLKDDEYPLITRVTLGPHEDVARIFLVDSRKTDEI 751
            .:|.|:.|...|..|:||...:...|   ::|.|||.||..|:..|| .|.|..|::....:.|:
Human   232 ALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGP-SDKALSFVLKENDSGEV 295

  Fly   752 SNEVAQFLNLSLPECR---AILERYDQELAREVAKIKERYAELRRRI 795
            :.:.     .|:||..   .||:|.::|..|:   |.::|:..|::|
Human   296 NWDA-----FSMPELHNFLRILQREEEEHLRQ---ILQKYSYCRQKI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 29/86 (34%)
Nore1-SARAH 762..799 CDD:293125 12/37 (32%)
RASSF1NP_733832.1 Mediates interaction with E4F1. /evidence=ECO:0000269|PubMed:14729613 2..119
C1_1 52..105 CDD:278556
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..203 7/23 (30%)
RASSF1_RA 198..293 CDD:176373 33/108 (31%)
Nore1-SARAH 299..338 CDD:293125 12/44 (27%)
MOAP1-binding 315..318 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157838
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S6693
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.690

Return to query results.
Submit another query.