DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rassf and LOC110440160

DIOPT Version :9

Sequence 1:NP_651126.3 Gene:Rassf / 42734 FlyBaseID:FBgn0039055 Length:806 Species:Drosophila melanogaster
Sequence 2:XP_021336131.1 Gene:LOC110440160 / 110440160 -ID:- Length:308 Species:Danio rerio


Alignment Length:327 Identity:96/327 - (29%)
Similarity:165/327 - (50%) Gaps:48/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 RDQKKPYQQGRQL--FEKGINRSKSGPSCFVYSDSDDDDEATL-------RPQRMATIRRSDIPQ 550
            :..|:.|.:..:|  |.....|......||:..:.:...|..|       ||.|   ::..|..:
Zfish     4 KSYKEAYNEDHELAGFPPSDKRLNDYYYCFLQEEGELIVEGLLNISWGLRRPIR---LQMHDDNE 65

  Fly   551 RYIQIQMDCYPKENVAAASEGESSRADAPSITSGAAAGDELTQTEDLYTASEGVDGPDGDGSAGL 615
            |:....|..:..|: ..:|..|:::....|         |....:...|....|||         
Zfish    66 RFRYACMGAWRSES-PESSRNENAKHQFCS---------EPNNNKISATTLSNVDG--------- 111

  Fly   616 HVTEDGVVLRRPPRTGASAIKRRSGNRRSRTKL----------KRRCSINGHYYNRETSFFTPPY 670
             |.||...|.| .|:.||.:     |.:.|:||          :.|.|||||:||.:||.|||.|
Zfish   112 -VEEDIPQLLR-TRSDASFV-----NIQRRSKLHSISDSQRIKRHRFSINGHFYNHKTSVFTPSY 169

  Fly   671 GSQMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSLFIVRDNGEQKRLKDDEYPLITRVTLGPHE 735
            ||..:|.|:|.:||.:|:||:|.|::|::....|.|::|.::||:.:|||.||||::|:..||.|
Zfish   170 GSVTNVRVNSNLTTQQVLNLLLNKFRVENKIDEFGLYLVHESGERTKLKDTEYPLVSRLLHGPCE 234

  Fly   736 DVARIFLVDSRKTDEISNEVAQFLNLSLPECRAILERYDQELAREVAKIKERYAELRRRIVSRME 800
            .:||||::::...:||:.:|||::...:|...:.:::..:|..||:.|:..:|..|:..|:.:::
Zfish   235 KIARIFIMETDLGEEITYDVAQYIKFEMPVLDSFIKKLKEEEEREILKLTRKYRMLKSVILQKLD 299

  Fly   801 SL 802
            .:
Zfish   300 GI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RassfNP_651126.3 LIM_TLP_like 4..57 CDD:188785
UBQ 660..744 CDD:294102 40/83 (48%)
Nore1-SARAH 762..799 CDD:293125 8/36 (22%)
LOC110440160XP_021336131.1 UBQ 159..245 CDD:320785 40/85 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1043350at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.