DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cow and CD74

DIOPT Version :9

Sequence 1:NP_001262857.1 Gene:Cow / 42733 FlyBaseID:FBgn0039054 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_016865578.1 Gene:CD74 / 972 HGNCID:1697 Length:321 Species:Homo sapiens


Alignment Length:244 Identity:58/244 - (23%)
Similarity:85/244 - (34%) Gaps:78/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 MRN---YNEVVEKQQQKFNKNSN-LNAYPSKSAECKPQQLTAIGNRL--LDWFSVIMADSKKRRQ 456
            |:|   |..:.|.......:|:: |..||...... |:.|..:.|.:  :||             
Human   128 MQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSF-PENLRHLKNTMETIDW------------- 178

  Fly   457 HSQKSKAHFPPACKTEAKWMFGHLDLNNDGQLSLQEMYDLEHDQNERCIKPFIDTCDLDTDSSIN 521
                         |....||...|            ::::.....|:  ||      .|....:.
Human   179 -------------KVFESWMHHWL------------LFEMSRHSLEQ--KP------TDAPPKVL 210

  Fly   522 TREWCRCFEKTDRPCAAVRRRIAGDFAGEIGAYAPDCDIQGFYKPTQCHNSVGVCWCVDKHGVEF 586
            |    :|.|:.....|.           ..|::.|.||..|.|.|.||:.|:|.||||..:|.|.
Human   211 T----KCQEEVSHIPAV-----------HPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEV 260

  Fly   587 ANTRTRGKPNCESVVNNAASLTSDDEDEG----ADDEDSAEGSADQMLV 631
            .|||:||..||      :.||..:|...|    ..|....:|.|:..||
Human   261 PNTRSRGHHNC------SESLELEDPSSGLGVTKQDLGPGKGLAEGHLV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CowNP_001262857.1 KAZAL <240..272 CDD:197624
SPARC_EC 427..539 CDD:238155 17/113 (15%)
SPARC_Ca_bdg 427..526 CDD:287550 14/100 (14%)
TY 535..597 CDD:238114 23/61 (38%)
CD74XP_016865578.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.