DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cow and NID2

DIOPT Version :10

Sequence 1:NP_001262857.1 Gene:Cow / 42733 FlyBaseID:FBgn0039054 Length:632 Species:Drosophila melanogaster
Sequence 2:XP_005267462.1 Gene:NID2 / 22795 HGNCID:13389 Length:1402 Species:Homo sapiens


Alignment Length:122 Identity:40/122 - (32%)
Similarity:52/122 - (42%) Gaps:27/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 DLEHDQNERCIKPFIDTCDLDTDSSINTREWCRC--------FE------KTDRPCAAVRRRIAG 545
            |::.....|| .| ..|| .:|..|.:    |||        |:      .:..||...:|....
Human   919 DVDECSENRC-HP-AATC-YNTPGSFS----CRCQPGYYGDGFQCIPDSTSSLTPCEQQQRHAQA 976

  Fly   546 DFAGEIGA--YAPDCDIQGFYKPTQCHNSVGVCWCVDKHGVEFANTRT---RGKPNC 597
            .:|.. ||  :.|.||.||.:.|.|||.|.|.|||||..|.|...|:|   ...|:|
Human   977 QYAYP-GARFHIPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHC 1032

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CowNP_001262857.1 KAZAL <240..272 CDD:197624
EFh_SPARC_TICN 428..533 CDD:320011 12/51 (24%)
EF-hand motif 469..500 CDD:320011 1/4 (25%)
EF-hand motif 501..533 CDD:320011 11/45 (24%)
TY 535..597 CDD:238114 27/66 (41%)
NID2XP_005267462.1 NIDO 108..273 CDD:214712
EGF_3 515..550 CDD:463759
G2F 552..784 CDD:214774
EGF_3 790..826 CDD:463759
EGF_CA 828..870 CDD:214542
EGF_3 879..917 CDD:463759
EGF_3 923..956 CDD:463759 11/39 (28%)
TY 966..1032 CDD:238114 27/66 (41%)
TY 1046..1111 CDD:238114
LY 1161..1199 CDD:214531
LY 1205..1247 CDD:214531
LY 1248..1292 CDD:214531
LY 1293..1335 CDD:214531
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.