DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cow and Cd74

DIOPT Version :9

Sequence 1:NP_001262857.1 Gene:Cow / 42733 FlyBaseID:FBgn0039054 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001036070.1 Gene:Cd74 / 16149 MGIID:96534 Length:279 Species:Mus musculus


Alignment Length:262 Identity:59/262 - (22%)
Similarity:100/262 - (38%) Gaps:66/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 YTAYKKDSKYQEDKHKMRNYNEVVEKQQQKFNKNSNLNAYPSKSAECKP----QQLTAIGNRLLD 442
            |..|::..:.  ||..:.:.|..:|..:.|..|::            ||    :..|.:..|.:.
Mouse    52 YFLYQQQGRL--DKLTITSQNLQLESLRMKLPKSA------------KPVSQMRMATPLLMRPMS 102

  Fly   443 WFSVIMADSKKRRQHSQKSKAHFPPACKTEAKWMFGHLDLNNDGQLSLQEM-----YDLEHDQN- 501
            ..::::...|...::...::.|..            || |...|.|...::     .:|:|.:| 
Mouse   103 MDNMLLGPVKNVTKYGNMTQDHVM------------HL-LTRSGPLEYPQLKGTFPENLKHLKNS 154

  Fly   502 ---------ERCIKPFIDTCDLDTDSSINTREWCRCFEKTDRPCAAVRRRIAGDFAGEIGAYAPD 557
                     |..:|.:     |..:.|.|:.|..:..|...:.....:..::...|...||:.|.
Mouse   155 MDGVNWKIFESWMKQW-----LLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPK 214

  Fly   558 CDIQGFYKPTQCHNSVGVCWCVDKHGVEFANTRTRGKPNCESVVNNAASLTSDDEDEGADDEDSA 622
            ||..|.|.|.|||.|.|.||||..:|.|..:|::||:.||               .|..|.||.:
Mouse   215 CDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNC---------------SEPLDMEDLS 264

  Fly   623 EG 624
            .|
Mouse   265 SG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CowNP_001262857.1 KAZAL <240..272 CDD:197624
SPARC_EC 427..539 CDD:238155 21/130 (16%)
SPARC_Ca_bdg 427..526 CDD:287550 20/117 (17%)
TY 535..597 CDD:238114 23/61 (38%)
Cd74NP_001036070.1 MHC2-interact 1..111 CDD:286400 12/72 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
MHCassoc_trimer 119..184 CDD:285980 15/82 (18%)
TY 195..254 CDD:238114 23/58 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.