DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6738 and CNDP1

DIOPT Version :10

Sequence 1:NP_651124.1 Gene:CG6738 / 42732 FlyBaseID:FBgn0039053 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_116038.4 Gene:CNDP1 / 84735 HGNCID:20675 Length:507 Species:Homo sapiens


Alignment Length:36 Identity:11/36 - (30%)
Similarity:18/36 - (50%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LYSFPVALTLVCFCSALGATLCYLLSQLVGRRLVKY 194
            ::|||:.:..||..|....:...|:.:.|.|.|..|
Human    12 IWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGY 47

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6738NP_651124.1 M20_AcylaseI_like 9..398 CDD:349898 11/36 (31%)
CNDP1NP_116038.4 M20_dipept_like_CNDP 38..506 CDD:349925 4/10 (40%)

Return to query results.
Submit another query.