DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6733 and DUG2

DIOPT Version :9

Sequence 1:NP_651123.1 Gene:CG6733 / 42731 FlyBaseID:FBgn0039052 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_009840.3 Gene:DUG2 / 852584 SGDID:S000000485 Length:878 Species:Saccharomyces cerevisiae


Alignment Length:479 Identity:101/479 - (21%)
Similarity:168/479 - (35%) Gaps:121/479 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NNEE-IKIFREYLRIPTVHPDVDYT------ACVEFLKRQASSLNLPVEVVYPAVQ-TKPVVIIK 64
            |||| :...||.:...||....|.|      .|..:|::...........::|... ..|||...
Yeast   433 NNEEMLNTLRELISFQTVSQSKDTTNTLSLRRCAIYLQQLFLKFGATNSQLFPLPDGGNPVVFAY 497

  Fly    65 WEG----SQ---PELSSIVLNSHTDVVP---VFREKWTHEPFSADIDEEGRIFARGTQDMKSVGT 119
            ::|    ||   .:...|:...|.||:.   .|  .|..:||:... |.|.:..||..|.|....
Yeast   498 FQGNGKVSQVKGAKKKRILWYGHYDVISSGNTF--NWNTDPFTLTC-ENGYLKGRGVSDNKGPLV 559

  Fly   120 QYLGAIRLLKASGFKPKRNLYVTFVPDEETGGHLGMAEFVKTDYYKKMNAGFSLDEGATSES--- 181
            ..:.::..|...|  ...|..|..|...|..|...:.: |...|:..:  |..:|....|.|   
Yeast   560 SAIHSVAYLFQQG--ELVNDVVFLVEGSEEIGSASLKQ-VCEKYHDII--GKDIDWILLSNSTWV 619

  Fly   182 DVHHLFYAERLRWGLK------LKV--------SGTSG--------------------HGSLLLP 212
            |..|    ..|.:||:      :||        ||.:|                    ...:::|
Yeast   620 DQEH----PCLNYGLRGVINAQIKVWSDKPDGHSGLNGGVYDEPMVNLVKIVSKLQNEQNEIMIP 680

  Fly   213 NTAGVKLNYLV-------NKLTEF----RTSQVENLARDSSLSKGDVTTVNLTQLSGGVQSNVVP 266
            |... .|..|.       .|:||.    ..:.|::|..:.:.....:|||   :.||.....|:|
Yeast   681 NFYS-PLKDLTEEEYQRFQKITELANIDENTTVQDLITNWTKPSLSMTTV---KFSGPGNITVIP 741

  Fly   267 PLFEAVFDIRIAITVNVVAFEKQIRDWCEE------AGGGIEIDFF-QKEPYIGPTKLDNSNPYW 324
            ........||:....:|...::.::.:.||      :...:||... :.|.::|    |.:|..:
Yeast   742 KSVTMGISIRLVPEQSVEQVKRDLKAYLEESFKQLKSQNHLEIKVLNEAEGWLG----DPTNHAY 802

  Fly   325 LAVKAAIDEL--GLKVHPIVCPGATDSRFIREKGT-------------PAIGFSPIINTTMRIHD 374
            ..:|   ||:  ...|.|::         :||.|:             ||:.. |...:|...|.
Yeast   803 QILK---DEITTAWDVEPLL---------VREGGSISCLRMLERIFDAPAVQI-PCGQSTDNGHL 854

  Fly   375 HDEFLQADVYLNGIDVYKKIIRNL 398
            .:|.|:...:.|..::..|:...|
Yeast   855 ANENLRIKNWSNLTEILSKVFNRL 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6733NP_651123.1 Ac-peptdase-euk 1..401 CDD:273850 101/479 (21%)
M20_AcylaseI_like 8..399 CDD:193524 101/479 (21%)
DUG2NP_009840.3 WD40 19..336 CDD:421866
WD40 repeat 23..60 CDD:293791
WD40 repeat 74..121 CDD:293791
WD40 repeat 126..158 CDD:293791
WD40 repeat 166..213 CDD:293791
WD40 repeat 226..280 CDD:293791
WD40 repeat 288..324 CDD:293791
WD40 repeat 343..372 CDD:293791
M20_dipept_like_DUG2_type 437..878 CDD:349926 96/473 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.