DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6733 and Cndp1

DIOPT Version :9

Sequence 1:NP_651123.1 Gene:CG6733 / 42731 FlyBaseID:FBgn0039052 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001007688.1 Gene:Cndp1 / 307212 RGDID:1359493 Length:492 Species:Rattus norvegicus


Alignment Length:319 Identity:64/319 - (20%)
Similarity:117/319 - (36%) Gaps:73/319 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 AVQTKPVVIIKWEGSQPELSSIVLNSHTDVVPVFREK-WTHEPFS-ADIDEEGRIFARGTQDMKS 116
            ::.|.|:::.:. |:.|:..|:....|.||.|..:|. |..:|:: .::|  |:::.||..|.|.
  Rat    82 SLPTPPIILAEL-GNDPKKPSVCFYGHLDVQPAQKEDGWLTDPYTLTEVD--GKLYGRGATDNKG 143

  Fly   117 VGTQYLGAIRLLKASGFKPKRNLYVTFVPD-EETGGHLGMAEFVKTDYYKKMNAGFSLDEGATSE 180
            ....::.|:...:|  .:....:.|.|:.: .|..|.:.:.|.||.             |.....
  Rat   144 PVLAWINAVSTFRA--LQQDLPVNVKFILEGMEEAGSVALEELVKR-------------EKDNFF 193

  Fly   181 SDVHHLFYAERLRWGLKLKVSGTSG-HGSLLLPNTAGVKLNYLVNKLTEFRTSQVENLARDSSLS 244
            |.|.::..::.| |..:.|.:.|.| .|:...                     .||...||....
  Rat   194 SGVDYIVISDNL-WLSQKKPALTCGTRGNCYF---------------------TVEVKCRDQDFH 236

  Fly   245 KG------DVTTVNLTQLSGGVQSNVVPPLFEAVFDIRIAITVNVVAFEKQIRDWCEEAGGGIEI 303
            .|      :....:|..|.|.:..:....|...::|....||.......:.|         .:::
  Rat   237 SGTFGGILNEPMADLVALLGSLVDSSGHILVPGIYDQMAPITEEEKTMYENI---------DLDL 292

  Fly   304 DFFQK----EPYIGPTKLDNSNPYWL-------AVKAAIDELGLKVHPIVCPGATDSRF 351
            :.:||    |.::..||.:.....|.       .::.|.||.|.|.   |.||....:|
  Rat   293 EEYQKSSRVERFLFDTKEELLTHLWRYPSLSIHGIEGAFDEPGTKT---VIPGRVLGKF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6733NP_651123.1 Ac-peptdase-euk 1..401 CDD:273850 64/319 (20%)
M20_AcylaseI_like 8..399 CDD:193524 64/319 (20%)
Cndp1NP_001007688.1 M20_dipept_like_CNDP 13..481 CDD:193551 64/319 (20%)
PRK08201 16..481 CDD:169276 64/319 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.