DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6733 and C44E12.1

DIOPT Version :9

Sequence 1:NP_651123.1 Gene:CG6733 / 42731 FlyBaseID:FBgn0039052 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_509287.1 Gene:C44E12.1 / 181023 WormBaseID:WBGene00016657 Length:351 Species:Caenorhabditis elegans


Alignment Length:411 Identity:80/411 - (19%)
Similarity:140/411 - (34%) Gaps:117/411 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KWENNEEIKIFREYLRIPTVHPDVDYTACVEFLKRQASSLNLPVEVVYPAVQTKPV--------- 60
            |||...|.::                   :|::...:::.|   |..:..|..|.:         
 Worm     4 KWEVEVEKRL-------------------LEYMSHSSTTGN---EAAFADVVAKDLEENGWTVYK 46

  Fly    61 ----------VIIKWEGSQPELSSIVLNSHTDVVPVFREKWTHEPFSADIDEEGRIFARGTQDMK 115
                      :...:..|.|:...::||:|.|.||         |:.....:|..|:..|:.|.|
 Worm    47 QSIPNSDRYNIYATFRNSDPKHVKVLLNTHLDTVP---------PYFPPTQDEQNIYGNGSNDAK 102

  Fly   116 SVGTQYLGAIRLLKASGFKPKRNLYVTFVPDEETGGHLGMAEFVKTDYYKKMNAGFSLDEGATSE 180
            ......:.|..::..:.....|.|.:.||..||. .|:||.|..|.:...:              
 Worm   103 GQLAAMVTAATIISKTDEDVARALGLLFVVGEEF-DHIGMIEANKLEILPE-------------- 152

  Fly   181 SDVHHLFYAE--RLRWG--------LKLKVSGTSGHGSLLLPNTAGVKLNYLVNKLTEFRTSQVE 235
                :|...|  .|::|        :||.|:|.:||..  .||:....::.::..|.:.:     
 Worm   153 ----YLLVGEPTELKFGTIQKGALKVKLTVTGQAGHSG--YPNSGSSAIHKMIEVLHDVQ----- 206

  Fly   236 NLARDSSLSKGDVTTVNLTQLSGGVQSNVVPPLFEAVFDIRIAITVNVVAFEKQIRDWCEEAGGG 300
             ||:....:....||.|:.::|||...|......||  ||...:..:|...:.|:   .....|.
 Worm   207 -LAKWPCDATNGATTYNIGKISGGQALNAWAANCEA--DIFFRVVTSVKDIQNQL---LALVNGR 265

  Fly   301 IEIDFFQKEPYIGPTKLDNSNPYWLAVKAAIDELGLKVHPIVCPGATDSRFI----REKGTPAIG 361
            .|:....   :..|..||..     .::|.:|.:...         ||..:.    :.|.....|
 Worm   266 AEVSLLS---FNDPVILDVP-----PIEAELDHVSFN---------TDIAYFDARDKVKAKYLFG 313

  Fly   362 FSPIINTTMRIHDHDEFLQAD 382
            ...|.|.    |..:||:..|
 Worm   314 GGSIKNA----HSKNEFIPKD 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6733NP_651123.1 Ac-peptdase-euk 1..401 CDD:273850 80/411 (19%)
M20_AcylaseI_like 8..399 CDD:193524 77/408 (19%)
C44E12.1NP_509287.1 M20_ArgE_DapE-like_fungal 9..344 CDD:349903 77/406 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0624
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1432382at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.