DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17111 and qsm

DIOPT Version :9

Sequence 1:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:381 Identity:84/381 - (22%)
Similarity:141/381 - (37%) Gaps:99/381 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 RVFCTRDEMTIKY-----NPKDWFVGKIY----ASMHSKDCLARGSGNGSVL-LTLQIGSEVKEN 405
            :|.|:.|:|.:..     ..||....:||    .....:.|..:..|:.:|. |:|   |:..| 
  Fly    28 KVHCSEDQMRVDIGLPDAESKDQSAPQIYLEGLKGYPDERCQPQIDGSLAVFRLSL---SDFYE- 88

  Fly   406 RCGILR-AYEMTQE---YQRTFISALVVIQNNPNVQTQGDRLIKVGCIQS---------NATTSL 457
             ||:.| ..::|.:   |.:..|.:           |.|..::.|.||.:         ||||. 
  Fly    89 -CGVTRMVNQLTGKKVYYHKIIIES-----------TSGKEIVSVKCITTASPAYNVMMNATTG- 140

  Fly   458 GVSVRDSSVDSS----------EPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQ 512
                 .||..:|          :.:|:.......||.|            .|.|...|.|.:|:.
  Fly   141 -----SSSTSTSSGGIHGLVKRDVLPAGFQEPEDLEIT------------TSLTKRAPEPRLSIG 188

  Fly   513 ILDLSHQHETND--VQIGQNLELQIVAEYSPQQLAEHMELQLAPLPDFRATSLVAKTADNENFVL 575
            : ....|..|.|  |:.|..|.::|           :::...||:.......|........:..|
  Fly   189 V-SQDGQKFTRDLTVKSGTPLTMEI-----------NLDEDSAPVYGLGVNYLDVTDTHTSSETL 241

  Fly   576 LIDERGCPTDASVFPALERVHTASRSMLRARFHAFKFSGTANVSFDVKIRFCVERCSPSNCISS- 639
            :.  :||..|..:|   |..:|....:|.|:|.||||..::.|.|...:..|:::|..:.|.:: 
  Fly   242 IF--KGCTVDPYLF---ENFNTIDGDILSAKFKAFKFPDSSYVQFRATVNVCLDKCLGTQCSNNQ 301

  Fly   640 -SWQRRRRQADQPDRRPEDLRVQNPVY-ISTVVDVAPQPDNFTRSQEELPLNYNIR 693
             .:.||:|          ::...|.|| ||..:.:..|........|.|.|...:|
  Fly   302 VGFGRRKR----------EISSANKVYEISLAMFLQVQDIEGVNKNEVLQLEEKLR 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532
qsmNP_001286637.1 ZP 30..298 CDD:214579 69/318 (22%)
Zona_pellucida <200..300 CDD:278526 26/115 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473247
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.