DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17111 and CG10005

DIOPT Version :9

Sequence 1:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster


Alignment Length:169 Identity:40/169 - (23%)
Similarity:67/169 - (39%) Gaps:35/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 VRVFCTRDEMTIKYNPKDWFVGKIYAS----MHSKDCLAR-GSGNGSVLLTLQIGSEVKENRCGI 409
            |.:.|..|.|.:....:..|:|.:|..    ..|..|..: .|..||  .|:::..::  ::|..
  Fly    56 VNLKCGADSMNVVLETEKPFMGVMYTRGSFYKQSAPCFMKPSSSQGS--RTMEMNFQL--DQCQT 116

  Fly   410 LRAYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGC---IQSNATTSLGVSVRD-----SSV 466
            :|..::        .:.:|||||:|.:.|.||....:.|   ...|......:..||     |.:
  Fly   117 IRDGDL--------YTNIVVIQNDPELITPGDSAFSLECDFRQPRNLDVEASMQARDRVATGSKI 173

  Fly   467 DSSEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHP 505
            ..:.|.|:|        .|||:  |..||..:.|....|
  Fly   174 TLTSPDPAA--------PTEHL--HNSVVSNSDSVAYIP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532
CG10005NP_650137.3 ZP 59..>162 CDD:214579 25/114 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.