DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17111 and CG12814

DIOPT Version :9

Sequence 1:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001262454.1 Gene:CG12814 / 41246 FlyBaseID:FBgn0037796 Length:441 Species:Drosophila melanogaster


Alignment Length:483 Identity:83/483 - (17%)
Similarity:144/483 - (29%) Gaps:171/483 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 VRVFCTRDEMTIKYNPKDWFVGKIYASMHSKD-----CLARGSGNGSVLLTLQI-GSEVKENRCG 408
            |...|....|.||......:.|    ::|.:|     |:|.|.|:..|..:|.: ..:...:.||
  Fly    42 VTATCKAGTMNIKVKMSSGYTG----AVHVRDYRTPGCMAMGDGSDQVAFSLNLWAKQGASDYCG 102

  Fly   409 IL----RAYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGVSVRDSSVDSS 469
            ||    .....|:|.     |..:.::.:..::...|:...:.|.:|.       ..||   |::
  Fly   103 ILVSNVSGSNRTEER-----SIQLAVRVHKTLELADDKFYVITCGKSG-------YARD---DNA 152

  Fly   470 EPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQILDLSHQHETNDVQIGQNLELQ 534
            ..|..  .||:.....|.::.||..:.                 .:.|..::|..:::|..... 
  Fly   153 HVVLK--FLENDHRVRETVYGHEYKIR-----------------AEFSKPNDTYGLRVGNCFAF- 197

  Fly   535 IVAEYSPQQLAEHMELQLAPLPDFRATSLVAKTADNENFV-LLIDERGCPTDASVFPALERVHTA 598
                                              |.:|.. .|.|:.|||.|:.:....  |.||
  Fly   198 ----------------------------------DKKNRTQKLTDDSGCPYDSKIISRF--VPTA 226

  Fly   599 SRSMLRARFHA-FKFSGTANVSFDVKIRFCVERCSPSNCISSSWQRRRRQADQPDRRPEDLRVQN 662
            ......|...: |||...:.|.....:..|..||                               
  Fly   227 DGRAAEAVLSSMFKFPEGSEVHLQCDVIQCYGRC------------------------------- 260

  Fly   663 PVYISTVVDVA--------PQPDNFTRSQEELPLNYNIRVHGPDQSNTNSYLYGERGVLLIAG-I 718
             |.|....|||        ..|..|..::|           |...:.|..::.......||:| .
  Fly   261 -VEIDDCNDVALAGFGKGTNGPRKFGPNEE-----------GSSLAGTTVFVLDPAEARLISGNC 313

  Fly   719 DDPLHLDNVCINQSLLIALFIFWLICQVALLFGCGMVLQRYRRLA--------KLEDERRRLHEE 775
            :|.:.            ..::.||...:.:||...:::..:...|        ::.::...:.||
  Fly   314 EDGIR------------PSWLLWLTITLGVLFLIMLLMNIFLCTAMSCSCANTEIIEKEPSIIEE 366

  Fly   776 YLEARRVHWADQG------------GYT 791
            |...|..|.:..|            |||
  Fly   367 YDPYRSWHGSQYGSRYSLHGRDAHKGYT 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532
CG12814NP_001262454.1 ZP 45..256 CDD:214579 51/285 (18%)
Zona_pellucida <181..256 CDD:278526 19/111 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473276
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.