DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and UBP6

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_116665.1 Gene:UBP6 / 850562 SGDID:S000001906 Length:499 Species:Saccharomyces cerevisiae


Alignment Length:99 Identity:29/99 - (29%)
Similarity:53/99 - (53%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VKWSGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAADNVKISALELKPNFKL 74
            ::.|||.||:.|:...|...|:.:....|||...|||.: :| .|.:..:::||..| :||...:
Yeast    10 IRHSGKVYPITLSTDATSADLKSKAEELTQVPSARQKYM-VK-GGLSGEESIKIYPL-IKPGSTV 71

  Fly    75 MMVGSTEADIEDACSLPDNIGEVVDDFDDADERE 108
            |::|:.:|::   .|.|......::|.  |.|::
Yeast    72 MLLGTPDANL---ISKPAKKNNFIEDL--APEQQ 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511 22/66 (33%)
HAD_IIID1 120..314 CDD:131299
UBP6NP_116665.1 Ubl1_cv_Nsp3_N-like 5..78 CDD:475130 23/70 (33%)
Peptidase_C19A 110..495 CDD:239122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.