DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and UBP6

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_564596.1 Gene:UBP6 / 841596 AraportID:AT1G51710 Length:482 Species:Arabidopsis thaliana


Alignment Length:105 Identity:33/105 - (31%)
Similarity:47/105 - (44%) Gaps:24/105 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIVKW-----SGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAADNVKISALE 67
            |.|||     .|.|..|.|...    |.:.:::..|.|.|||||::   .||....|:...:|:.
plant     4 VSVKWQKKVLDGIEIDVSLPPY----VFKAQLYDLTGVPPERQKIM---VKGGLLKDDGDWAAIG 61

  Fly    68 LKPNFKLMMVGST-------EADIEDACSLPD-----NIG 95
            :|...||||:|:.       |..|..|..||:     |:|
plant    62 VKDGQKLMMMGTADEIVKAPEKAIVFAEDLPEEALATNLG 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511 22/71 (31%)
HAD_IIID1 120..314 CDD:131299
UBP6NP_564596.1 Ubl_USP14_like 1..75 CDD:340521 26/77 (34%)
Peptidase_C19A 105..476 CDD:239122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.