DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and AT5G54210

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_200232.1 Gene:AT5G54210 / 835509 AraportID:AT5G54210 Length:306 Species:Arabidopsis thaliana


Alignment Length:196 Identity:46/196 - (23%)
Similarity:76/196 - (38%) Gaps:60/196 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 KKL-LVLDIDYTL-----FDHRSPAET-------------------GTEL---MRPYLHEFLTSA 176
            ||| ||||:|:||     ..:.:..||                   .:|.   :||::||||..|
plant    87 KKLHLVLDLDHTLLHTVMISNLTKEETYLIEEEDSREDLRRLNGGYSSEFLIKLRPFVHEFLKEA 151

  Fly   177 YEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMF-----------YLDSTAMISVHVPERGVV 230
            .:.:.:.:::.....:....:.|:     |..||.|           |:.:..:  |...|.|||
plant   152 NKMFSMYVYTMGDRDYAMNVLNLI-----DPEKVYFGDRVITRNESPYIKTLDL--VLADECGVV 209

  Fly   231 DVKPLGVIWALYK-------QYNSSNTIMFDDIRRNFLMNPKSGLKIRPFRQAHLNRGTDTELLK 288
            .|.....:|..:|       :||     .|.|..|:.:...||..:.:  |....|.|:...:||
plant   210 IVDDTPHVWPDHKRNLLEITKYN-----YFSDKTRHDVKYTKSYAEEK--RDESRNDGSLANVLK 267

  Fly   289 L 289
            :
plant   268 V 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511
HAD_IIID1 120..314 CDD:131299 46/196 (23%)
AT5G54210NP_200232.1 FCP1_euk 83..234 CDD:131304 36/158 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.