DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and AT5G45700

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_199382.1 Gene:AT5G45700 / 834609 AraportID:AT5G45700 Length:272 Species:Arabidopsis thaliana


Alignment Length:181 Identity:45/181 - (24%)
Similarity:74/181 - (40%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 EGKKLLVLDIDYTLFDHRS-------------PAETGTEL-----MRPYLHEFLTSAYEDYDIVI 184
            |.||.:|||:|.||. |.|             |...|..|     .||.:.|||....|.|.||:
plant    95 ETKKTIVLDLDETLV-HSSMEKPEVPYDFVVNPKIDGQILTFFVIKRPGVDEFLKKIGEKYQIVV 158

  Fly   185 WSATSMRW-------IEEKMRLLGVASNDNYKVMFYLDSTAMISVHVPERGVVDVKPLGVIWALY 242
            ::|....:       ::.:.|::..:        ||.|:.:.|...:       ||.||.:    
plant   159 FTAGLREYASLVLDKLDPERRVISRS--------FYRDACSEIDGRL-------VKDLGFV---- 204

  Fly   243 KQYNSSNTIMFDDIRRNFLMNPKSGLKIRPFRQAHLNRGTDTELLKLSDYL 293
             ..:....::.||...::.:.|::...|:||.    :...|.||.||.::|
plant   205 -MRDLRRVVIVDDNPNSYALQPENAFPIKPFS----DDLEDVELKKLGEFL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511
HAD_IIID1 120..314 CDD:131299 45/181 (25%)
AT5G45700NP_199382.1 HIF-SF_euk 97..250 CDD:274055 43/177 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.