DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and CPL2

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001190199.1 Gene:CPL2 / 831743 AraportID:AT5G01270 Length:774 Species:Arabidopsis thaliana


Alignment Length:200 Identity:35/200 - (17%)
Similarity:62/200 - (31%) Gaps:87/200 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DYKIKELAPPREGKKL--------------------------LVLDIDYTL--------FDHRSP 157
            |.:|..:|.|.:.||.                          :|.|:|.||        |:.|..
plant    99 DEEIHLVAMPSKEKKFPCFWCFSVPSGLYDSCLRMLNTRCLSIVFDLDETLIVANTMKSFEDRIE 163

  Fly   158 AETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMFYLDSTAMIS- 221
            |          |..:::...:...|...||...|:::::|.|.....||     :..|:..::. 
plant   164 A----------LKSWISREMDPVRINGMSAELKRYMDDRMLLKQYIDND-----YAFDNGVLLKA 213

  Fly   222 -------------------VHVPERGVV--DVKP----------LGVIWALYKQYNSSNTIMFDD 255
                               :.:||:..|  .:||          |...|...:.|.::.|     
plant   214 QPEEVRPTSDGQEKVCRPVIRLPEKNTVLTRIKPEIRDTSVLVKLRPAWEELRSYLTAKT----- 273

  Fly   256 IRRNF 260
             |:.|
plant   274 -RKRF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511
HAD_IIID1 120..314 CDD:131299 34/199 (17%)
CPL2NP_001190199.1 HAD_FCP1-like <244..355 CDD:319823 7/39 (18%)
DSRM_RNAse_III_family 657..720 CDD:380682
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.