| Sequence 1: | NP_651118.1 | Gene: | Ublcp1 / 42726 | FlyBaseID: | FBgn0027526 | Length: | 320 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001190199.1 | Gene: | CPL2 / 831743 | AraportID: | AT5G01270 | Length: | 774 | Species: | Arabidopsis thaliana |
| Alignment Length: | 200 | Identity: | 35/200 - (17%) |
|---|---|---|---|
| Similarity: | 62/200 - (31%) | Gaps: | 87/200 - (43%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 127 DYKIKELAPPREGKKL--------------------------LVLDIDYTL--------FDHRSP 157
Fly 158 AETGTELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMFYLDSTAMIS- 221
Fly 222 -------------------VHVPERGVV--DVKP----------LGVIWALYKQYNSSNTIMFDD 255
Fly 256 IRRNF 260 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ublcp1 | NP_651118.1 | Ubl_UBLCP1 | 12..79 | CDD:340511 | |
| HAD_IIID1 | 120..314 | CDD:131299 | 34/199 (17%) | ||
| CPL2 | NP_001190199.1 | HAD_FCP1-like | <244..355 | CDD:319823 | 7/39 (18%) |
| DSRM_RNAse_III_family | 657..720 | CDD:380682 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||