DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and UBP7

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_566680.2 Gene:UBP7 / 821682 AraportID:AT3G21280 Length:532 Species:Arabidopsis thaliana


Alignment Length:111 Identity:28/111 - (25%)
Similarity:55/111 - (49%) Gaps:9/111 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVVIVKWSGKEY-PVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAADNVKISALELK 69
            :.|.|||..|.: .:::.......|.:.:::..:.|.|||||::   .||....|:...|.|.||
plant    57 LTVSVKWQKKVFESIEIDTSQPPFVFKAQLYDLSGVPPERQKIM---VKGGLLKDDADWSTLGLK 118

  Fly    70 PNFKLMMVGSTEADIEDACSLPDNIGEVVDDFDDADEREESVEHSA 115
            ...||||:|:.    ::....|:.....::|..: :::..::.:||
plant   119 NGQKLMMMGTA----DEIVKAPEKGPVFMEDLPE-EQQAANLGYSA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511 20/67 (30%)
HAD_IIID1 120..314 CDD:131299
UBP7NP_566680.2 Ubl_USP14_like 56..130 CDD:340521 24/79 (30%)
Peptidase_C19A 160..526 CDD:239122 28/111 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.