DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and AT2G04930

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_178570.1 Gene:AT2G04930 / 815040 AraportID:AT2G04930 Length:277 Species:Arabidopsis thaliana


Alignment Length:249 Identity:60/249 - (24%)
Similarity:89/249 - (35%) Gaps:81/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KVQRRVRDYKIKELAPPREG----------------KKL-LVLDIDYTLFDHR-----SPAE--- 159
            |.|.|..||..|.|....|.                ||| ||||:|:||...:     |.||   
plant    29 KSQFRKFDYIFKGLQLSNEAVALTKSLTTKHSCLNEKKLHLVLDLDHTLLHSKLVSNLSQAERYL 93

  Fly   160 -------TGTEL---------------MRPYLHEFLTSAYEDYDIVIWSATS-------MRWIEE 195
                   |..:|               :||::.:||..|.|.:.:.:::..|       :..|:.
plant    94 IQEASSRTREDLWKFRPIGHPIDRLIKLRPFVRDFLKEANEMFTMFVYTMGSRIYAKAILEMIDP 158

  Fly   196 KMRLLG--VASNDNYKVMFYLDSTAMISVHVPERGVVDVKPLGVIWALYKQYNSSNTIMFDDIRR 258
            |....|  |.:.|....|..|:     .|...|||||.|.....||..:|    :|.|..    |
plant   159 KKLYFGNRVITKDESPRMKTLN-----LVLAEERGVVIVDDTRDIWPHHK----NNLIQI----R 210

  Fly   259 NFLMNPKSGLKIRPFRQAHLNRG-TDTELLKLSDYLRKIAHHCPDFNSLNHRKW 311
            .:....:|||....:.:...:.| .|..|..:...||::           ||::
plant   211 KYKYFRRSGLDSNSYSEKKTDEGENDGGLANVLKLLREV-----------HRRF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511
HAD_IIID1 120..314 CDD:131299 60/249 (24%)
AT2G04930NP_178570.1 FCP1_euk 61..215 CDD:131304 42/166 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.