DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and AT2G02290

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_178335.1 Gene:AT2G02290 / 814760 AraportID:AT2G02290 Length:302 Species:Arabidopsis thaliana


Alignment Length:166 Identity:34/166 - (20%)
Similarity:61/166 - (36%) Gaps:60/166 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 EGKKL-LVLDIDYTL----------------------------FDHRSPAETGTELMRPYLHEFL 173
            |.||| ||||:|:||                            |:...|.|:..:| |.::|:||
plant    83 EDKKLHLVLDLDHTLVHTIKVSQLSESEKYITEEVESRKDLRRFNTGFPEESLIKL-RSFVHQFL 146

  Fly   174 TSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMFYLDSTAMIS------------VHVPE 226
            ....|.:.:.:::.....:.:..:.::     |..|:.|   ...:|:            |...|
plant   147 KECNEMFSLYVYTKGGYDYAQLVLEMI-----DPDKIYF---GNRVITRRESPGFKTLDLVLADE 203

  Fly   227 RGVVDVKPLGVIW----------ALYKQYNSSNTIM 252
            ||:|.|.....:|          |.||.:...:.::
plant   204 RGIVVVDDKSSVWPHDKKNLLQIARYKYFGDQSCLL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511
HAD_IIID1 120..314 CDD:131299 34/166 (20%)
AT2G02290NP_178335.1 FCP1_euk 81..232 CDD:131304 34/157 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.