DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and Ctdnep1

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_080293.1 Gene:Ctdnep1 / 67181 MGIID:1914431 Length:244 Species:Mus musculus


Alignment Length:252 Identity:57/252 - (22%)
Similarity:94/252 - (37%) Gaps:88/252 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 VYLAKVQRRVRD--------YKIKELAP------PREGKKLLVLDIDYTLF-DH-----RSPAET 160
            :||  ::|::|.        |.|..|:|      .:..:|:||||:|.||. .|     |.....
Mouse    25 IYL--LRRQIRTVIQYQTVRYDILPLSPLSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRP 87

  Fly   161 GTE------------------LMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDN 207
            ||.                  ..||::..||....:.|::|:::|:        |.:.|.|..|.
Mouse    88 GTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTAS--------MEIYGSAVADK 144

  Fly   208 -------YKVMFYLDSTAMISVHVPERGVVDVKPLGVIWALYKQYNSSNTIMFDDIRRNFLMNPK 265
                   .|..:|.....:      |.|.. :|.|.|:.:     :.|:.::.|:....:..:|.
Mouse   145 LDNSRSILKRRYYRQHCTL------ELGSY-IKDLSVVHS-----DLSSIVILDNSPGAYRSHPD 197

  Fly   266 SGLKIR-----PFRQAHLNRGTDTELLKLSDYLRKIAHHCPDFNSL------NHRKW 311
            :.:.|:     |...|.||      ||.:.|.||..|    |..|:      .||.|
Mouse   198 NAIPIKSWFSDPSDTALLN------LLPMLDALRFTA----DVRSVLSRNLHQHRLW 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511
HAD_IIID1 120..314 CDD:131299 55/248 (22%)
Ctdnep1NP_080293.1 HIF-SF_euk 61..229 CDD:274055 44/197 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.