DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and usp14

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_956267.1 Gene:usp14 / 335736 ZFINID:ZDB-GENE-030131-7676 Length:489 Species:Danio rerio


Alignment Length:99 Identity:33/99 - (33%)
Similarity:52/99 - (52%) Gaps:15/99 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VIVKWSGKEY--PVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAAD----NVKISAL 66
            |.||| |||.  .|:|..::...|.:.::|..|.|:|||||::   .||.|..|    |:|    
Zfish     6 VNVKW-GKEKFDAVELNTEEPPMVFKAQLFALTGVQPERQKVM---VKGGTLKDDEWGNIK---- 62

  Fly    67 ELKPNFKLMMVGSTEADIEDACSLPDNIGEVVDD 100
             ||....|:|:||.:|..|:....|..:.::.::
Zfish    63 -LKNGMTLLMMGSADALPEEPVVRPMFVEDMTEE 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511 25/72 (35%)
HAD_IIID1 120..314 CDD:131299
usp14NP_956267.1 Ubl_USP14_like 3..76 CDD:340521 30/78 (38%)
Peptidase_C19A 106..481 CDD:239122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.