DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and Ctdsp1

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001408190.1 Gene:Ctdsp1 / 227292 MGIID:2654470 Length:302 Species:Mus musculus


Alignment Length:139 Identity:27/139 - (19%)
Similarity:61/139 - (43%) Gaps:28/139 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDN---YKVMFYLDSTAMISVHVP 225
            |.||::.|||....|.::.|:::|:..::.:....||     |.   ::...:.:|.      |.
Mouse   171 LKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLL-----DKWGAFRARLFRESC------VF 224

  Fly   226 ERG--VVDVKPLGVIWALYKQYNSSNTIMFDDIRRNFLMNPKSGLKIRPFRQAHLNRGTDTELLK 288
            .||  |.|:..||        .:....::.|:...:::.:|.:.:.:..:    .:..:||||..
Mouse   225 HRGNYVKDLSRLG--------RDLRRVLILDNSPASYVFHPDNAVPVASW----FDNMSDTELHD 277

  Fly   289 LSDYLRKIA 297
            |..:..:::
Mouse   278 LLPFFEQLS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511
HAD_IIID1 120..314 CDD:131299 27/139 (19%)
Ctdsp1NP_001408190.1 HIF-SF_euk 90..290 CDD:274055 27/139 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.