DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ublcp1 and usp-14

DIOPT Version :10

Sequence 1:NP_651118.1 Gene:Ublcp1 / 42726 FlyBaseID:FBgn0027526 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_497006.1 Gene:usp-14 / 175105 WormBaseID:WBGene00006856 Length:489 Species:Caenorhabditis elegans


Alignment Length:116 Identity:33/116 - (28%)
Similarity:58/116 - (50%) Gaps:23/116 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VVIVKWSGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAADNVKISALELKPN 71
            :|.|||..::|.|::.......|.:.::|..|||.|||||::.:   |:|..|: ....:.:|.|
 Worm     3 IVNVKWQKEKYVVEVDTSAPPMVFKAQLFALTQVVPERQKVVIM---GRTLGDD-DWEGITIKEN 63

  Fly    72 FKLMMVGSTEADIEDACSLPDNIGEV-----VDDFDDADEREESVEHSAVY 117
            ..:||:||              :||:     |.:...|:..:::.|.||:|
 Worm    64 MTIMMMGS--------------VGEIPKPPTVLEKKQANRDKQAEEISALY 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ublcp1NP_651118.1 Ubl_UBLCP1 12..79 CDD:340511 20/66 (30%)
HAD_IIID1 120..314 CDD:131299
usp-14NP_497006.1 Ubl_USP14_like 1..73 CDD:340521 25/87 (29%)
Peptidase_C19A 103..456 CDD:239122
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.