DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17119 and YCL002C

DIOPT Version :9

Sequence 1:NP_651116.1 Gene:CG17119 / 42723 FlyBaseID:FBgn0039045 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_009924.4 Gene:YCL002C / 850353 SGDID:S000000508 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:57/241 - (23%)
Similarity:103/241 - (42%) Gaps:47/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 NYRRKSVEGLNFDFLALNIVGFTLYSMFNCGLYFI------EDLQNEYEVRYPLGVNPVMLND-- 210
            |...:|:.||::|...|:.||..||  ..|.|::.      |.|...:.:.||       |||  
Yeast    25 NKLHRSIYGLSYDLFLLDFVGNGLY--LYCALHYCYSSLVREQLSQRFPLFYP-------LNDAR 80

  Fly   211 -------VVFSLHAMFATCITILQCFFYQRA----QQRVSFIAYGILAIFAVVVVVSAGL----- 259
                   ::.....:...|:.:|:..:|.|:    .|.:|..:..|:::|.|:.:.:.|.     
Yeast    81 SIPISSFLILKDFCVSCCCMMVLRQLYYYRSTKHIYQGISITSIIIISVFLVLGIFTYGCSISNL 145

  Fly   260 ----AGGSVIHWLDFLYYCSYVKLTITIIKYVPQALMNYRRKSTSGWSIGNILLDFTGGTLSMLQ 320
                :|...:.:|:.:.|...:...:...|||||..:|:...||.|.|....|:.|...::.:|.
Yeast   146 PLKNSGKFGVFYLEHINYLWVMANLLKCFKYVPQMSINWMGCSTVGLSSKFALISFLAESIDLLG 210

  Fly   321 MIL---NAHNYDDWVSIFGDPTKFGLGL--FSVLFDVFFMLQHYVF 361
            .::   ||..|:    |..:.|.|.:.|  |..|..:...:| ||:
Yeast   211 RLVIPTNALFYE----IPFNSTPFWVKLIQFVTLLVILCQVQ-YVY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17119NP_651116.1 2A43 129..362 CDD:130026 57/241 (24%)
PQ-loop 132..187 CDD:282099 12/32 (38%)
PQ-loop 272..324 CDD:282099 14/54 (26%)
YCL002CNP_009924.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.