DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and Rdh10

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_598593.1 Gene:Rdh10 / 98711 MGIID:1924238 Length:341 Species:Mus musculus


Alignment Length:308 Identity:93/308 - (30%)
Similarity:146/308 - (47%) Gaps:40/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAV 121
            |:.|.:|...||.|.        .:.:..|||.|:|:|.|:||.||||||...||.|||...|.:
Mouse     9 VVTFKVLWAFVLAAA--------RWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVL 65

  Fly   122 VDVNSKGCYETVELLSKIPRCVAKA------------------------YKNDVSSPRELQLMAA 162
            .|:|::...||..::..|.|.:..|                        |..||.....:.|.|.
Mouse    66 WDINTQSNEETAGMVRHIYRDLEAADAAALQAGKGEEEILPPCNLQVFTYTCDVGKRENVYLTAE 130

  Fly   163 KVEKELGPVDILVNNASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAV 227
            :|.||:|.|.:|||||.::..........:.|:..:.:|..::..|||.|||.|:....||:|.|
Mouse   131 RVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTV 195

  Fly   228 NALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGI 292
            .:..||....|...|.|:|:|:.||.|||..||:.::.|.::||:...||:    |..:.....|
Mouse   196 ASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLV----DTGMFRGCRI 256

  Fly   293 AKS----YPGLPTPYVAEKIVKGVLLNERMVYVPKIFALSVWLLRLLP 336
            .|.    .|.|...|..::.::.:|.::.||..|::..:..::..:||
Mouse   257 RKEIEPFLPPLKPDYCVKQAMRAILTDQPMVCTPRLMYIVTFMKSILP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 83/274 (30%)
NADB_Rossmann 94..338 CDD:304358 82/271 (30%)
Rdh10NP_598593.1 adh_short 37..252 CDD:278532 71/218 (33%)
17beta-HSDXI-like_SDR_c 38..307 CDD:187598 82/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.