DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and NRE1

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:NRE1 / 854853 SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:54/248 - (21%)
Similarity:98/248 - (39%) Gaps:53/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYK-------- 148
            |||.||||...|:|:             ::|||......:||  :..:.|..|...|        
Yeast     2 GKVILVTGVSRGIGK-------------SIVDVLFSLDKDTV--VYGVARSEAPLKKLKEKYGDR 51

  Fly   149 -----NDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSDEIDT-----ILQLNLG 203
                 .|::....|:.:.....|..|.:|.||.||.::    .|....:|||.     :..:|..
Yeast    52 FFYVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVL----EPVQNVNEIDVNAWKKLYDINFF 112

  Fly   204 SYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSDCDYV 268
            |.:......||: :.:.:|::|.|::.|..:.....|.|.::|..:..|..:|..|.|     .|
Yeast   113 SIVSLVGIALPE-LKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANEER-----QV 171

  Fly   269 RTTVANAYLMRTSGDLPLLSDAGIAKSYPGLPTPYVAE--KIVKGVLLNERMV 319
            :.......::.|...:.:..:.|        |:...||  |:.:|:..|.:::
Yeast   172 KAIAVAPGIVDTDMQVNIRENVG--------PSSMSAEQLKMFRGLKENNQLL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 54/248 (22%)
NADB_Rossmann 94..338 CDD:304358 52/246 (21%)
NRE1NP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 52/246 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3540
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.