DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and YDL114W

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_010169.1 Gene:YDL114W / 851444 SGDID:S000002272 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:64/246 - (26%)
Similarity:117/246 - (47%) Gaps:44/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 KHLLDY---LFALGLKEKDVSGK--VALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETV 133
            |||.|:   :.:|......:..|  .||:|||.||||.|:..||:||..|:.|.|:.|...:..|
Yeast    15 KHLKDFPSVILSLPSYNPSILSKNATALITGGSSGLGFELAKELSRRINKVIVADIQSFPTFAQV 79

  Fly   134 ELLSKIPRCVAKAYKN------DVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSD 192
            |            |.|      |::|..|::.:...:|::.|.::|::|||.:..:.....:.:.
Yeast    80 E------------YNNIFYYQCDITSLDEIKNLKKAIERDHGNINIIINNAGVAHIKKLEHMTNK 132

  Fly   193 EIDTILQLNL-GSY-IMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMES 255
            |::.::.:|| |:| |::|  |...||:.:.|.::.:.::.|.:.......|.|:|..:.||.:.
Yeast   133 EVEQLIDINLIGAYRIIST--FAEDMIDNREGFIINIASVLGELTPARLTSYGASKGAMIGFHKC 195

  Fly   256 LRAELR--LSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKS--YPGLPTP 302
            :....|  .::|:             .:|...||...|..|:  :..:|||
Yeast   196 MSRHFRSLSTECN-------------KTGIKTLLVCPGKIKTNMFIDVPTP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 59/226 (26%)
NADB_Rossmann 94..338 CDD:304358 58/221 (26%)
YDL114WNP_010169.1 17beta-HSDXI-like_SDR_c 40..282 CDD:187598 58/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I1741
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1486
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - mtm9177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.