DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and SDR2

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_190736.1 Gene:SDR2 / 824331 AraportID:AT3G51680 Length:303 Species:Arabidopsis thaliana


Alignment Length:214 Identity:55/214 - (25%)
Similarity:99/214 - (46%) Gaps:14/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKN 149
            |..|.:.||||::|||..|:|:...:..||.|..:.:.||::.......:.||........|:.:
plant    27 LYPKRLEGKVAIITGGAHGIGKATVMLFARHGATVVIADVDNVAGSSLAKSLSSHKTSPMVAFIS 91

  Fly   150 -DVSSPRELQLMAAKVEKELGPVDILVNNASLM----PMTSTPSLKSDEIDTILQLNLGSYIMTT 209
             |||...:::.:........|.:|||.|||.::    ...|.....:||.|.::::|:....:..
plant    92 CDVSVEADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDFDADEFDHVMRVNVRGVGLGM 156

  Fly   210 KEFLPKMINRK-SGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELR--------LSDC 265
            |.....||.|. .|.:::..::||::...|...|||:|:.|.|..::...||.        :|..
plant   157 KHGARAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTKNAACELGKYGIRVNCISPF 221

  Fly   266 DYVRTTVANAYLMRTSGDL 284
            ....:.:.||:...:.||:
plant   222 GVATSMLVNAWRKTSGGDV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 53/208 (25%)
NADB_Rossmann 94..338 CDD:304358 51/205 (25%)
SDR2NP_190736.1 PLN02253 23..296 CDD:177895 55/214 (26%)
NADB_Rossmann 31..295 CDD:304358 53/210 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.