DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and SDR3

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_182235.1 Gene:SDR3 / 819326 AraportID:AT2G47130 Length:257 Species:Arabidopsis thaliana


Alignment Length:261 Identity:64/261 - (24%)
Similarity:108/261 - (41%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GLKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAK--- 145
            ||:   :.||:|::|||.||:|.|........|.|:.:||...       ||...:...|.|   
plant     3 GLR---LDGKIAIITGGASGIGAEAVRLFTDHGAKVVIVDFQE-------ELGQNVAVSVGKDKA 57

  Fly   146 -AYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMT-STPSLKSDEIDTILQLNLGSYIMT 208
             .|:.||::.:|::.......::.|.:|:|.:||.:|... |...|..::.|..:.:|:......
plant    58 SFYRCDVTNEKEVENAVKFTVEKYGKLDVLFSNAGVMEQPGSFLDLNLEQFDRTMAVNVRGAAAF 122

  Fly   209 TKEFLPKMINRKS-GHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSDCDYVRTTV 272
            .|.....|:.:.: |.:|...::|..:..||...|||:|:.:.|.::|....|            
plant   123 IKHAARAMVEKGTRGSIVCTTSVASEIGGPGPHAYTASKHALLGLVKSACGGL------------ 175

  Fly   273 ANAYLMRTSGDLPLLSDAGI----------AKSYPGLPTPYVAEKIVKGVLLNERMVYVPKIFAL 327
             ..|.:|.:|..|......|          .:.|.      .|..|:|||:|..|.|....:|..
plant   176 -GKYGIRVNGVAPYAVATAINSRDEETVRMVEEYS------AATGILKGVVLKARHVAEAALFLA 233

  Fly   328 S 328
            |
plant   234 S 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 62/254 (24%)
NADB_Rossmann 94..338 CDD:304358 60/251 (24%)
SDR3NP_182235.1 PLN02253 1..254 CDD:177895 64/261 (25%)
NADB_Rossmann 5..252 CDD:304358 62/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.