DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and AT2G17845

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_565425.1 Gene:AT2G17845 / 816294 AraportID:AT2G17845 Length:312 Species:Arabidopsis thaliana


Alignment Length:335 Identity:85/335 - (25%)
Similarity:131/335 - (39%) Gaps:107/335 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NDETTRAIFNLKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREIC 109
            |.:|.|.|        ||||.|..                    ::..||.||||..||:|||:|
plant    30 NHQTVREI--------LLLLYLTC--------------------ELKDKVVLVTGASSGIGREVC 66

  Fly   110 LELARRGCKLAVVDVNSKGCYETVELLSKIPR------CVAKAYKNDVSSPRELQLMAAKVEKEL 168
            |:||:.|||:...   ::.......|.|:|.|      ..|:|.:.||||.      ||.|:|.:
plant    67 LDLAKAGCKIIAA---ARRVDRLKSLCSEINRFEYSAGIQAEALELDVSSD------AATVQKAV 122

  Fly   169 -------GPVDILVNNASLM-PMTSTPSLKSDEIDTILQLNLGSYIMTTKE--FLPKMINRKSGH 223
                   |.:|.|:|||... .:.|:..|..||.|.:.:.||....:.:|.  .|.:...|..|.
plant   123 KKAWEIFGKIDALINNAGFRGNVKSSLDLSEDEWDKVFKTNLTGTWLVSKYVCILMRDAKRGGGS 187

  Fly   224 LVAVNALAGL--VPLPGAGIYTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPL 286
            ::.:::::.|  ..:||...|..:|.|::.....:..||             ..|.:|.:...| 
plant   188 VINISSVSWLHRGQVPGGVAYACSKGGVDTMTRMMALEL-------------GVYKIRVNSIAP- 238

  Fly   287 LSDAGIAKSYPGLPTPYVAEKIVKGVLLNERMVYVPKIFALSVWLL----RLLPTKWQDYM---- 343
                |:.||           :|.:|::..|             ||.    |.:|.|.|..:    
plant   239 ----GLLKS-----------EITQGLMQKE-------------WLKTVIERTVPLKVQQTVDPGL 275

  Fly   344 --LLRFYHFD 351
              |||:...|
plant   276 TSLLRYLVHD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 75/285 (26%)
NADB_Rossmann 94..338 CDD:304358 69/265 (26%)
AT2G17845NP_565425.1 fabG 47..303 CDD:235546 76/290 (26%)
SDR_c 52..298 CDD:212491 74/285 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.