DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and si:dkey-221h15.4

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001373167.1 Gene:si:dkey-221h15.4 / 563950 ZFINID:ZDB-GENE-041014-340 Length:350 Species:Danio rerio


Alignment Length:283 Identity:84/283 - (29%)
Similarity:140/283 - (49%) Gaps:15/283 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSK 127
            :..|:|.|||........|.:...:|||.|::.||||..:|:|:.|..||...|..|.:.|:||:
Zfish    16 IFELILGAVFYFFEAFVRFFIPRSKKDVEGEIVLVTGAANGIGKLIAKELGHYGATLVLWDINSE 80

  Fly   128 GCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMP-----MTSTP 187
            ...:|.:.|.::......||..|.|...|:..:|..|::|:|.|.||||||.::.     :.:..
Zfish    81 ALEKTAKELKQVLDVRVYAYTCDCSRRSEVYRVAEVVKREVGDVSILVNNAGMVSGKYTFLEAPD 145

  Fly   188 SLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGF 252
            ||    :|..|::|..::..|.|.|||.|:.:..|||:.|.....|..:.|...|.|:|.....|
Zfish   146 SL----VDRTLRVNAAAHFWTYKAFLPAMLEQDHGHLLCVACHGALFAMNGLADYCASKSAAVRF 206

  Fly   253 MESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKSY--PGLPTPYVAEKIVKGVLLN 315
            .||:..||.:...:.::||:...||:.|:    :.......:.:  |.|...|.|::||..:|..
Zfish   207 AESIALELLVLKKEGIKTTIVCPYLINTN----MFGGCQTKRPFFLPVLEQRYAAKQIVDAILQE 267

  Fly   316 ERMVYVPKIFALSVWLLRLLPTK 338
            :..:.:|...:|.:.|..::|.|
Zfish   268 KMYLLLPSSLSLLMALKSVMPAK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 75/255 (29%)
NADB_Rossmann 94..338 CDD:304358 73/250 (29%)
si:dkey-221h15.4NP_001373167.1 17beta-HSDXI-like_SDR_c 47..269 CDD:187598 69/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.