DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and HSD17B11

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_057329.3 Gene:HSD17B11 / 51170 HGNCID:22960 Length:300 Species:Homo sapiens


Alignment Length:289 Identity:89/289 - (30%)
Similarity:144/289 - (49%) Gaps:29/289 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LLLLPLVL---LAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVV 122
            ||||||::   |..|:|     || :..:.|.|:|::.|:||.|.|:||....|.|:...||.:.
Human     8 LLLLPLLIVCSLESFVK-----LF-IPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLW 66

  Fly   123 DVNSKGCYETVELLSKIPRCVAK--AYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTS 185
            |:|..|..||.   :|.....||  .:..|.|:..::...|.||:.|:|.|.||||||.::..:.
Human    67 DINKHGLEETA---AKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSD 128

  Fly   186 TPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIE 250
            ..:.:..:|:...::|:.::..|||.|||.|.....||:|.|.:.||.|.:|....|.::|:...
Human   129 LFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAV 193

  Fly   251 GFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKS-----YPGLPTPYVAEKIVK 310
            ||.::|..||.......|:||..          .|...:.|..|:     .|.|....|..:::.
Human   194 GFHKTLTDELAALQITGVKTTCL----------CPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMH 248

  Fly   311 GVLLNERMVYVPKIFALSVWLLRLLPTKW 339
            |:|..::|:::|...|....|.|:||.::
Human   249 GILTEQKMIFIPSSIAFLTTLERILPERF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 76/256 (30%)
NADB_Rossmann 94..338 CDD:304358 75/250 (30%)
HSD17B11NP_057329.3 17beta-HSDXI-like_SDR_c 38..277 CDD:187598 75/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.