DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and sro

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:335 Identity:74/335 - (22%)
Similarity:126/335 - (37%) Gaps:96/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ALGLKEKDV---SGKVALVTGGGSGLGREI---------------CLELARRGCKLAVVDVNSKG 128
            :|||..:.:   |..|.|:||..||||..:               |..:...|.||.      :|
  Fly    13 SLGLGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEGAKLL------QG 71

  Fly   129 CYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGP-----VDILVNNASLMPMTSTPS 188
            .....:.||::     ...:.|:..|..::|:..::...|..     :..|:|||.:|.......
  Fly    72 LASAKDGLSRM-----HTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEW 131

  Fly   189 LKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFM 253
            ..:::|:..:..||...:..|.|.|| ::.::.|.::.|.:..||..||..|.|.|:|..:..:.
  Fly   132 QLTEQIEAQINCNLLGTMRLTHELLP-LLRQQQGRIINVTSHCGLQALPALGPYAASKAALRFWT 195

  Fly   254 ESLRAELRLSDCDYVR---------TTVA-----------------------------NAYLMRT 280
            :|||.||:....:.|.         :.:|                             |.||...
  Fly   196 DSLRVELQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSAEQHALYDTYFEAFNGYLKVL 260

  Fly   281 SGDLP---LLSDAGIAKSYPGLPTP-----YVAEKIVKGVLLNERMVYVPKIFALSVWLLRLLPT 337
            ||..|   |.:::.:||....|.:.     |:.|               |:.:.|..||..|.||
  Fly   261 SGFKPPNRLRNESLLAKFKDALTSSQPLALYIEE---------------PRRYRLYRWLFTLCPT 310

  Fly   338 KWQDYMLLRF 347
            ...|::.:||
  Fly   311 PLVDWLTVRF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 71/323 (22%)
NADB_Rossmann 94..338 CDD:304358 66/309 (21%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 61/299 (20%)
adh_short 28..229 CDD:278532 48/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447495
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.