DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and naz

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster


Alignment Length:162 Identity:41/162 - (25%)
Similarity:71/162 - (43%) Gaps:18/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 EKDVSGKVALVTGGGSGLGREICLELARRGCKL-------------AVVDVNSKGCYETVELLSK 138
            :..:..::.:||||.||:|.||...||.||.::             |.:.....||...:..|.:
  Fly    44 DNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDE 108

  Fly   139 ----IPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSDEIDTILQ 199
                ..|...:|...|:.|.|.:...|.::..|...:|:|||||.:: ..:|.....|..:...|
  Fly   109 DDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVV-FANTQMPTEDGFERHSQ 172

  Fly   200 LNLGSYIMTTKEFLPKMINRKSGHLVAVNALA 231
            :|..:..:.|...||.:...:.|.::.|:|.|
  Fly   173 VNYLAPFLLTHLLLPHLQRSEQGRILFVSAHA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 41/158 (26%)
NADB_Rossmann 94..338 CDD:304358 41/155 (26%)
nazNP_001287387.1 FabG 47..318 CDD:223959 41/159 (26%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 41/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.