DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and HSD11B1L

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001254797.1 Gene:HSD11B1L / 374875 HGNCID:30419 Length:333 Species:Homo sapiens


Alignment Length:338 Identity:91/338 - (26%)
Similarity:132/338 - (39%) Gaps:66/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TAVPAGAVTVTGPTASATPTATQAAAQAHRNDETTRAIFNLKVIVFLLLLPLVLLAVFLKHLLDY 79
            |.:|..|.:|  |..||.|         ||         .:||     ||...|.|:|..:..|.
Human    28 TGMPVPATSV--PCPSAGP---------HR---------TMKV-----LLLTGLGALFFAYYWDD 67

  Fly    80 LFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVA 144
            .|    ....:.|...|:||..:|:|.|:....||.|..|.:.       ..|..||.|:   |.
Human    68 NF----DPASLQGARVLLTGANAGVGEELAYHYARLGSHLVLT-------AHTEALLQKV---VG 118

  Fly   145 KAYK----------NDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSDEIDTILQ 199
            ...|          .|::||...:.:......:||.:|.||.|........|.:........::|
Human   119 NCRKLGAPKVFYIAADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQ 183

  Fly   200 LNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSD 264
            :|..||:..|...||.:.:.| |.||.|::|.|.||...:..|:|.|:.::||..|||.||.:.|
Human   184 VNFVSYVQLTSRALPSLTDSK-GSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQD 247

  Fly   265 CDYVRTTVANAYLMRTSGDLPLLSDAGIAKSYPGL------PTPYVAEKIVKGVLLNERMVYVPK 323
            .:...|...          |.|...|..|::..|:      |.|..|..:::|.......|:.|.
Human   248 VNVAITMCV----------LGLRDRASAAEAVRGVTRVKAAPGPKAALAVIRGGATRAAGVFYPW 302

  Fly   324 IFALSVWLLRLLP 336
            .|.|...|.|.||
Human   303 RFRLLCLLRRWLP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 72/262 (27%)
NADB_Rossmann 94..338 CDD:304358 71/259 (27%)
HSD11B1LNP_001254797.1 GVQW 3..>26 CDD:290611
NADB_Rossmann 74..302 CDD:304358 65/248 (26%)
PRK08251 78..302 CDD:181324 64/244 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3540
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.