DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and CG8888

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:257 Identity:59/257 - (22%)
Similarity:96/257 - (37%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AAQAHRNDETTRAIFNLKVIVFLLLLPLVLLAVFLKHLLD----------YLFALG--------- 84
            :|...::.|....||....:.||......::...|.|.||          ..|||.         
  Fly    23 SALPQKSHEIPWDIFERLFMPFLFCQAAAIVTSHLLHALDISSISTFAVFVWFALATVGAVLFYH 87

  Fly    85 LKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVE------LLSKIPRCV 143
            ..:...|||..|:||..:.|...:..:|...|..:..      |....:|      :|.::....
  Fly    88 FVKVSASGKGVLITGCEAPLAWYLAKKLDDLGFTVYA------GFNTPIEESDEAKILKEVTSGR 146

  Fly   144 AKAYKNDVSSPRELQLMAAKVEKEL--GPVDI--LVNNASLMPMTSTPSLKSDEIDTILQLNLGS 204
            .|....||:|.:.:...|..|.:.|  |...:  :|:.|..:.:.....:....:...|.|||..
  Fly   147 MKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVLRKSLDLNLLG 211

  Fly   205 YIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSDCD 266
            ....|:.||| ::.|..|.:|.:.:....||.|..||..||:..::.|...||.|:|....|
  Fly   212 SARLTQIFLP-LVRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVD 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 46/186 (25%)
NADB_Rossmann 94..338 CDD:304358 43/183 (23%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 44/184 (24%)
adh_short 96..293 CDD:278532 44/184 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.