DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and CG30491

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:281 Identity:70/281 - (24%)
Similarity:116/281 - (41%) Gaps:72/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAVFLKHLLDYLFALG---LKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCY 130
            ||.|:|.|:.     |   .||.:.:|||.:|||..:|:|:|...|:|:||..:.:...|.|.|.
  Fly    24 LAFFVKDLMQ-----GGQFTKETNETGKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCE 83

  Fly   131 E-----TVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLK 190
            |     .:|..:|...|    .:.|::|...::...|..::|...:.:|:|||.:  |....||.
  Fly    84 EAREEIVLETKNKYVYC----RQCDLASQESIRHFVAAFKREQEHLHVLINNAGV--MRCPRSLT 142

  Fly   191 SDEIDTILQLN-LGSYIMTTKEFLPKMINRKS-GHLVAVNALAGLVPLPGAGIYTATKYGIEGFM 253
            ||.|:..|.:| :|.:::|  ..|..::.:.| ..:|.|::||                      
  Fly   143 SDGIELQLGVNHMGHFLLT--NLLLDLLKKSSPSRIVNVSSLA---------------------- 183

  Fly   254 ESLRAELRLSDCD----------YVRTTVANAYLMRTSGDLPLLSDAGIAKSYPGLPTPYVAEKI 308
             ..|.|:...|.:          |.::.:||....|.           :||...|  |...|..:
  Fly   184 -HTRGEINTGDLNSDKSYDEGKAYSQSKLANVLFTRE-----------LAKRLEG--TNVTANAL 234

  Fly   309 VKGVLLNE---RMVYVPKIFA 326
            ..||:..|   .|.:....||
  Fly   235 HPGVVDTEIIRHMGFFNNFFA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 62/256 (24%)
NADB_Rossmann 94..338 CDD:304358 60/253 (24%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 62/257 (24%)
NADB_Rossmann 45..319 CDD:304358 62/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.