DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and CG9265

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:264 Identity:84/264 - (31%)
Similarity:138/264 - (52%) Gaps:17/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 YLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVELLSKIPRCV 143
            |..|.|..||:::..:||:||||:||||.:...|.:.|.|:.:.|:|.||..|||:::.:... .
  Fly    73 YYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGG-Y 136

  Fly   144 AKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASL---MPMTSTPSLKSDEIDTILQLNLGSY 205
            .|.|..|:|...|:...|..:..|:|.:.:|:|||.:   :.:..||   ...|:....:|:.::
  Fly   137 CKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTP---DHLIERSFNVNVMAH 198

  Fly   206 IMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSDCDYVRT 270
            ..|||.||||||....||:..:.:|||.|.:.....|.|:|:...||.|:||.||.:.....:||
  Fly   199 FWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRT 263

  Fly   271 TVANAYLMRTSGDLPLLSDAGIAKSYPGLPTPYVAEKIVKGVLLNERMVYVPKIFALSVWLLRLL 335
            |....:.::.:|   :..|.. |:..|.|....||::::..:..||::..:|.      :|..||
  Fly   264 TCICPFFIQATG---MFDDVN-ARWVPTLNPNDVADRVIAAIRKNEKLAVIPG------FLKVLL 318

  Fly   336 PTKW 339
            ..||
  Fly   319 SFKW 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 79/252 (31%)
NADB_Rossmann 94..338 CDD:304358 77/246 (31%)
CG9265NP_001260655.1 fabG 82..299 CDD:235546 72/224 (32%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447540
Domainoid 1 1.000 91 1.000 Domainoid score I1741
eggNOG 1 0.900 - - E2759_KOG1201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1486
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - mtm9177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.