DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and Rdh10

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_852143.1 Gene:Rdh10 / 353252 RGDID:727793 Length:341 Species:Rattus norvegicus


Alignment Length:310 Identity:92/310 - (29%)
Similarity:149/310 - (48%) Gaps:34/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKL 119
            :.::|...|:...:|..|:.....:|  :..|||.|:|:|.|:||.||||||...||.|||...|
  Rat     1 MNIVVEFFLVTFKVLWAFVLAAARWL--VRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALL 63

  Fly   120 AVVDVNSKGCYETVELLSKIPRCVAKA------------------------YKNDVSSPRELQLM 160
            .:.|:|::...||..::..|.|.:..|                        |..||.....:.|.
  Rat    64 VLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPPCNLQVFTYTCDVGKRENVYLT 128

  Fly   161 AAKVEKELGPVDILVNNASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLV 225
            |.:|.||:|.|.:|||||.::..........:.|:..:.:|..::..|||.|||.|:....||:|
  Rat   129 AERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIV 193

  Fly   226 AVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDA 290
            .|.:..||....|...|.|:|:|:.||.|||..||:.::.|.::||:...||:    |..:....
  Rat   194 TVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLV----DTGMFRGC 254

  Fly   291 GIAKS----YPGLPTPYVAEKIVKGVLLNERMVYVPKIFALSVWLLRLLP 336
            .|.|.    .|.|...|..::.:|.:|.::.|:..|::..:..::..:||
  Rat   255 RIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMKSILP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 83/274 (30%)
NADB_Rossmann 94..338 CDD:304358 82/271 (30%)
Rdh10NP_852143.1 17beta-HSDXI-like_SDR_c 38..307 CDD:187598 82/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.