DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and CG6012

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_609817.1 Gene:CG6012 / 35022 FlyBaseID:FBgn0032615 Length:308 Species:Drosophila melanogaster


Alignment Length:243 Identity:60/243 - (24%)
Similarity:101/243 - (41%) Gaps:58/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKN 149
            |||:  .|..|.|||...|:|:|...||||:...:.::       ..|.|.|..:.:.:|     
  Fly    44 LKER--FGDWAAVTGASDGIGKEYAKELARQNINVVLI-------ARTEEKLQAVAKEIA----- 94

  Fly   150 DVSSPRELQLMAA----------KVEKELG--PVDILVNNASLMPMTSTPSLKSDEIDTILQLNL 202
            |..:..:.:::.|          .:|||..  |:.|||||..:....|......:|...|:..|:
  Fly    95 DCGAGVQTKIVIADFTKGSQVYEHIEKETANIPISILVNNVGIATPKSLLKYNQEETQNIIDTNV 159

  Fly   203 GSYIMTTKEFLPKM-INRKSGHLVAVNALAGLVPLPGAGIYTATK----------------YGIE 250
            .:....::.|..:| .::..|.:|.|.:...|.|||....|.|:|                ||| 
  Fly   160 VAVSQLSRIFFQRMKASKLKGAIVNVGSGTELQPLPNGAYYAASKAYTRSLTLALYHEAKPYGI- 223

  Fly   251 GFMESLRAELRLSDCDYVRTTVANAY---LMRTSGDLPLLSDAGIAKS 295
                    .:::...::|.|.: |:|   :|:  |.|.:.|.:..|||
  Fly   224 --------HVQMLSPNFVVTKI-NSYSRQIMK--GGLLIPSASAYAKS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 57/237 (24%)
NADB_Rossmann 94..338 CDD:304358 56/234 (24%)
CG6012NP_609817.1 17beta-HSD1_like_SDR_c 49..296 CDD:187614 57/236 (24%)
adh_short 51..243 CDD:278532 49/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.