DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and scu

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_523396.1 Gene:scu / 32789 FlyBaseID:FBgn0021765 Length:255 Species:Drosophila melanogaster


Alignment Length:272 Identity:63/272 - (23%)
Similarity:110/272 - (40%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VSGKVALVTGGGSGLGREICLELARRGCKLAVVDV-NSKGCYETVELLSKIPRCVAKAYKNDVSS 153
            :...|:|||||.|||||.....||::|..:.:.|: :|||.....||..|:.....     ||:|
  Fly     2 IKNAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPV-----DVTS 61

  Fly   154 PRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSL------KSDEIDTILQLN---------LG 203
            .:::.......:.:.|.:|:.||.|.......|.:.      :.::...::.:|         |.
  Fly    62 EKDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLS 126

  Fly   204 SYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSDCDYV 268
            :.:|...|  |....:: |.:|...::|......|...|:|:|..:.|....:..:|....   :
  Fly   127 AGLMGANE--PNQDGQR-GVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLSTQG---I 185

  Fly   269 RTTVANAYLMRTS--GDLPLLSDAGIAKSYP-----GLPTPY--VAEKIVKGVLLNERMVYVPKI 324
            |.......|..|.  ..||......:|||.|     |.|:.|  :.:.|.:..|||..::.:.  
  Fly   186 RICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYENPLLNGEVIRID-- 248

  Fly   325 FALSVWLLRLLP 336
                 ..||::|
  Fly   249 -----GALRMMP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 63/271 (23%)
NADB_Rossmann 94..338 CDD:304358 63/268 (24%)
scuNP_523396.1 HSD10-like_SDR_c 3..255 CDD:187629 62/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447543
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.