DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and Mfe2

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:225 Identity:60/225 - (26%)
Similarity:98/225 - (43%) Gaps:21/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GKVALVTGGGSGLGREICLELARRGCKLAVVDV---------NSKGCYETVELLSKIPRCVAKAY 147
            |:||:|||.|:|||||..|..|.||.|:.|.|:         :.:.....|:.:.|........|
  Fly    12 GRVAVVTGAGAGLGREYALLFAERGAKVVVNDLGGTHSGDGASQRAADIVVDEIRKAGGEAVADY 76

  Fly   148 KNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEF 212
            .:.:...:.::...    |..|.||||||||.::...|.......:.:.:..::|......|:..
  Fly    77 NSVIDGAKVIETAI----KAFGRVDILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAA 137

  Fly   213 LPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSD--CDYVRTTVANA 275
            .|.|..:..|.::..::.:|:....|...|||.|.|:.|...::..|...::  |:.:..|.|: 
  Fly   138 FPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVIVPTAAS- 201

  Fly   276 YLMRTSGDLPLLSDAGIAKSYPGLPTPYVA 305
              ..|.|.||   |....:..|.|..|.||
  Fly   202 --RMTEGILP---DILFNELKPKLIAPVVA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 60/225 (27%)
NADB_Rossmann 94..338 CDD:304358 59/223 (26%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 60/225 (27%)
PRK07791 11..248 CDD:236099 60/225 (27%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.