DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and CG31810

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:217 Identity:68/217 - (31%)
Similarity:103/217 - (47%) Gaps:26/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IVFLLLLPLVLLAVFLKHLLDYLFALGLKE--KDVSGKVALVTGGGSGLGREICLELARRGCKLA 120
            ||..|...|..|...:|.:::..|...|.:  .:..|..|:|||...|:|:|...||||:|..|.
  Fly    20 IVAYLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIGKEYARELARQGLNLV 84

  Fly   121 VVD---------VNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVD--IL 174
            :|.         .|..|....|    ||...||     |.:..||:.   |.:||||..::  ||
  Fly    85 LVSRKEEKLIAVTNEIGSQYNV----KIKWIVA-----DFAKGREVY---AHIEKELNGIEVGIL 137

  Fly   175 VNN-ASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPG 238
            ||| .::....|...:..|.:..:|.:|:||..|.|::.||:||:|:.|.:|.:.:.:.|.|.|.
  Fly   138 VNNVGTIHDPESLDKVSEDMLWDLLTVNVGSVTMLTRKILPQMISRRKGAIVNLGSSSELQPHPN 202

  Fly   239 AGIYTATKYGIEGFMESLRAEL 260
            ...|.|||..:..|.:.|..|:
  Fly   203 LTAYAATKKFVTHFTKGLEYEV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 60/182 (33%)
NADB_Rossmann 94..338 CDD:304358 59/179 (33%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 68/217 (31%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 60/181 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.