DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and CG3842

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster


Alignment Length:308 Identity:74/308 - (24%)
Similarity:131/308 - (42%) Gaps:68/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AVPAGAVTVTGPTASATPTATQAAAQAHRNDETT---RAIFNLKVIVFLLLLPLVLLAVFLKHLL 77
            |.|.|:|..|.......|||...        |.|   |..:...|::||::|.::|....|:..:
  Fly     5 ATPPGSVPGTVFPPGFDPTAESV--------EKTLCFRGFWAWAVLIFLIVLGILLFMWLLRKCI 61

  Fly    78 D---YLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRG------------CKLAVVDVNSK 127
            .   |     .|...:.|||.:|||..:|:|:|..||||:||            |:.|.:|:..:
  Fly    62 QGPAY-----RKANRIDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDR 121

  Fly   128 GCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSD 192
            .  ...:|.::         ..|:.|.:.::....:.:.|...:|||:|||.:|....|  |.:|
  Fly   122 S--RNQQLFNR---------TLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRT--LTAD 173

  Fly   193 EIDTILQLN-LGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESL 256
            ..:....:| ||.:::|.. .|.::.:.....:|.|::.|.|             :|... .|.|
  Fly   174 GFEQQFGVNHLGHFLLTNL-LLDRLKHSSPSRIVVVSSAAHL-------------FGRIN-REDL 223

  Fly   257 RAELRLSDC--DYVRTTVAN-AYLMRTSGDLPLLSDAGIAKS--YPGL 299
            .:|...|..  .|.::.:|| .:.::.|   .:|.|.|:..:  :||:
  Fly   224 MSEKNYSKFFGAYSQSKLANILFTLKLS---TILKDTGVTVNCCHPGV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 55/227 (24%)
NADB_Rossmann 94..338 CDD:304358 53/224 (24%)
CG3842NP_001259270.1 FabG 71..319 CDD:223959 55/229 (24%)
NADB_Rossmann 74..347 CDD:304358 55/226 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.