DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and Dhrs3

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001032276.3 Gene:Dhrs3 / 313689 RGDID:1305584 Length:302 Species:Rattus norvegicus


Alignment Length:292 Identity:94/292 - (32%)
Similarity:147/292 - (50%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LLLLPLVLLAVFLKHLLDYLFALGL----KEKDVSGKVALVTGGGSGLGREICLELARRGCKLAV 121
            |::|||.::.:..|      .|:||    |.:|:|.:..|:||||.|:||.:..|.|.||.:..|
  Rat     9 LVVLPLQMIYLVTK------AAVGLVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARKIV 67

  Fly   122 VDVNSKGCY-ETVELLSKI-PRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNA------ 178
            :...::.|. ||.|.:.:: ..|  ..:..||.:..|:..||..|.:::|.:.||||||      
  Rat    68 LWGRTEKCLKETTEEIRQMGTEC--HYFICDVGNREEVYQMAKAVREKVGDITILVNNAAVVHGK 130

  Fly   179 SLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYT 243
            |||.......|||..::|     ||.: .|||.|||:|:..::||:|.:|::..|..:|||..|.
  Rat   131 SLMDSDDDALLKSQHVNT-----LGQF-WTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYC 189

  Fly   244 ATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKSYPGLPTPY----V 304
            .:|.....|||||  .|.|.||..|..|....:  .||.::    ..|:...:|.|..|.    |
  Rat   190 TSKASAFAFMESL--TLGLLDCPGVSATTVLPF--HTSTEM----FQGMRVRFPNLFPPLKPETV 246

  Fly   305 AEKIVKGVLLNERMVYVPKIFALSVWLLRLLP 336
            |.:.|:.|..|:.::.:|....:.:.|..:||
  Rat   247 ARRTVEAVQQNQALLLLPWTMNILIILKSILP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 84/258 (33%)
NADB_Rossmann 94..338 CDD:304358 83/255 (33%)
Dhrs3NP_001032276.3 PRK09072 35..288 CDD:236372 85/260 (33%)
17beta-HSDXI-like_SDR_c 53..281 CDD:187598 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.