DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and CG3603

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:169 Identity:57/169 - (33%)
Similarity:87/169 - (51%) Gaps:8/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSP 154
            ::||||||||.|||:||..|..|||.|.|:..||.|.|...|||:.|....   :.|.:.||||.
  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSER---SAALEVDVSSA 67

  Fly   155 RELQLMAAKVEKEL--GPVDILVNNASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMI 217
            :.:|...|:..|:.  .|. |:||:|.:........:...:.|.:..:||....:.|:.:...||
  Fly    68 QSVQFSVAEALKKFQQAPT-IVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMI 131

  Fly   218 NRK--SGHLVAVNALAGLVPLPGAGIYTATKYGIEGFME 254
            .:|  :|.:|.::::...:...|...|.|||.|:..|.|
  Fly   132 EQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 57/168 (34%)
NADB_Rossmann 94..338 CDD:304358 55/165 (33%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 57/169 (34%)
BKR_SDR_c 9..248 CDD:187594 56/166 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.