DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and Hsd17b13

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001009684.1 Gene:Hsd17b13 / 305150 RGDID:1359553 Length:300 Species:Rattus norvegicus


Alignment Length:289 Identity:83/289 - (28%)
Similarity:147/289 - (50%) Gaps:18/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKL 119
            :.:|:.||||..:::..:|:.|:.  |.:..:.|.|:|:..|:||.|.|:||....|.|::..:|
  Rat     1 MNLILELLLLVGIIIYSYLESLVK--FFIPQRRKSVAGQTVLITGAGHGIGRLTAYEFAKQKSRL 63

  Fly   120 AVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMT 184
            .:.|::..|..||.....|: ..|...:..|.|:..|:.....:|:||:|.::|:||||..:...
  Rat    64 VLWDISKHGVEETAAKCRKL-GAVVHVFVVDCSNRAEIYKSVDQVKKEVGDIEIVVNNAGAIYPA 127

  Fly   185 STPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGI 249
            ...|.|.:||....::|:..:....|..||.|:.|.|||:|.|.::.|...:|....|.::|:..
  Rat   128 DLLSTKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHRVIPYLIPYCSSKFAA 192

  Fly   250 EGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKS-----YPGLPTPYVAEKIV 309
            .||..:|.|||     |.:..|.     ::||...|:..:.|..|:     :|.|....||..::
  Rat   193 VGFHRALTAEL-----DTLGKTG-----IKTSCLCPVFVNTGFTKNPSTRLWPVLEPDEVARSLI 247

  Fly   310 KGVLLNERMVYVPKIFALSVWLLRLLPTK 338
            .|:|.|::|::||....:|:.:....|.:
  Rat   248 DGILTNKKMIFVPSYINISLIVEMFFPER 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 73/253 (29%)
NADB_Rossmann 94..338 CDD:304358 72/248 (29%)
Hsd17b13NP_001009684.1 adh_short 37..228 CDD:278532 59/201 (29%)
17beta-HSDXI-like_SDR_c 38..277 CDD:187598 72/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.